![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein automated matches [190047] (37 species) not a true protein |
![]() | Species Escherichia coli [TaxId:316385] [272313] (3 PDB entries) |
![]() | Domain d4pc1b1: 4pc1 B:8-204 [272322] Other proteins in same PDB: d4pc1a2, d4pc1a3, d4pc1b2, d4pc1b3, d4pc1c1, d4pc1c2, d4pc1c3, d4pc1d1, d4pc1d2, d4pc1d3 automated match to d1d8ta3 complexed with gol, pb, po4, trs |
PDB Entry: 4pc1 (more details), 1.95 Å
SCOPe Domain Sequences for d4pc1b1:
Sequence, based on SEQRES records: (download)
>d4pc1b1 c.37.1.8 (B:8-204) automated matches {Escherichia coli [TaxId: 316385]} tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak ilelagfldsyipeper
>d4pc1b1 c.37.1.8 (B:8-204) automated matches {Escherichia coli [TaxId: 316385]} tkphvnvgtighvdhgkttltaaittvlaktyggshveydtptrhyahvdcpghadyvkn mitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelve mevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeper
Timeline for d4pc1b1: