| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.43: EF-Ts domain-like [54712] (2 superfamilies) beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123 |
Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) ![]() comprises two structural repeats of this fold |
| Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (2 proteins) |
| Protein Elongation factor Ts (EF-Ts), dimerisation domain, N-terminal domain [419040] (2 species) |
| Species Escherichia coli [TaxId:562] [419524] (6 PDB entries) species duplication: consists of two subdomains of this fold |
| Domain d4pc3c2: 4pc3 C:55-139 [272320] Other proteins in same PDB: d4pc3a1, d4pc3a2, d4pc3a3, d4pc3b1, d4pc3b2, d4pc3b3, d4pc3c1, d4pc3c3, d4pc3d1, d4pc3d3 automated match to d1efub4 complexed with gdp, gol |
PDB Entry: 4pc3 (more details), 1.83 Å
SCOPe Domain Sequences for d4pc3c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pc3c2 d.43.1.1 (C:55-139) Elongation factor Ts (EF-Ts), dimerisation domain, N-terminal domain {Escherichia coli [TaxId: 562]}
vaadgviktkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqf
eeervalvakigeninirrvaaleg
Timeline for d4pc3c2: