Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (19 species) not a true protein |
Species Escherichia coli [TaxId:316385] [272315] (3 PDB entries) |
Domain d4pc6b2: 4pc6 B:205-296 [272316] Other proteins in same PDB: d4pc6a1, d4pc6a3, d4pc6b1, d4pc6b3, d4pc6c1, d4pc6c2, d4pc6c3, d4pc6d1, d4pc6d2, d4pc6d3 automated match to d1efca1 complexed with gnp, gol |
PDB Entry: 4pc6 (more details), 2.2 Å
SCOPe Domain Sequences for d4pc6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pc6b2 b.43.3.0 (B:205-296) automated matches {Escherichia coli [TaxId: 316385]} aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl ldegragenvgvllrgikreeiergqvlakpg
Timeline for d4pc6b2: