Lineage for d4pc6b1 (4pc6 B:8-204)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125254Protein automated matches [190047] (29 species)
    not a true protein
  7. 2125312Species Escherichia coli [TaxId:316385] [272313] (3 PDB entries)
  8. 2125316Domain d4pc6b1: 4pc6 B:8-204 [272314]
    Other proteins in same PDB: d4pc6a2, d4pc6a3, d4pc6b2, d4pc6b3, d4pc6c1, d4pc6c2, d4pc6c3, d4pc6d1, d4pc6d2, d4pc6d3
    automated match to d1d8ta3
    complexed with gnp, gol

Details for d4pc6b1

PDB Entry: 4pc6 (more details), 2.2 Å

PDB Description: elongation factor tu:ts complex with bound gdpnp
PDB Compounds: (B:) elongation factor tu

SCOPe Domain Sequences for d4pc6b1:

Sequence, based on SEQRES records: (download)

>d4pc6b1 c.37.1.8 (B:8-204) automated matches {Escherichia coli [TaxId: 316385]}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeper

Sequence, based on observed residues (ATOM records): (download)

>d4pc6b1 c.37.1.8 (B:8-204) automated matches {Escherichia coli [TaxId: 316385]}
tkphvnvgtighvdhgkttltaaittvlaktyggkargishveydtptrhyahvdcpgha
dyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeel
lelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeper

SCOPe Domain Coordinates for d4pc6b1:

Click to download the PDB-style file with coordinates for d4pc6b1.
(The format of our PDB-style files is described here.)

Timeline for d4pc6b1: