| Class b: All beta proteins [48724] (176 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
| Protein automated matches [254425] (14 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [272305] (1 PDB entry) |
| Domain d4pc3a3: 4pc3 A:297-393 [272312] Other proteins in same PDB: d4pc3a1, d4pc3a2, d4pc3b1, d4pc3b2, d4pc3c1, d4pc3c2, d4pc3c3, d4pc3d1, d4pc3d2, d4pc3d3 automated match to d1d8ta2 complexed with gdp, gol |
PDB Entry: 4pc3 (more details), 1.83 Å
SCOPe Domain Sequences for d4pc3a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pc3a3 b.44.1.0 (A:297-393) automated matches {Escherichia coli [TaxId: 83333]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg
Timeline for d4pc3a3: