![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
![]() | Protein automated matches [226946] (19 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [272303] (1 PDB entry) |
![]() | Domain d4pc3a2: 4pc3 A:205-296 [272311] Other proteins in same PDB: d4pc3a1, d4pc3a3, d4pc3b1, d4pc3b3, d4pc3c1, d4pc3c2, d4pc3c3, d4pc3d1, d4pc3d2, d4pc3d3 automated match to d1efca1 complexed with gdp, gol |
PDB Entry: 4pc3 (more details), 1.83 Å
SCOPe Domain Sequences for d4pc3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pc3a2 b.43.3.0 (A:205-296) automated matches {Escherichia coli [TaxId: 83333]} aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl ldegragenvgvllrgikreeiergqvlakpg
Timeline for d4pc3a2: