Lineage for d4pc3a2 (4pc3 A:205-296)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1791735Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1792044Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 1792045Protein automated matches [226946] (19 species)
    not a true protein
  7. 1792086Species Escherichia coli [TaxId:83333] [272303] (1 PDB entry)
  8. 1792087Domain d4pc3a2: 4pc3 A:205-296 [272311]
    Other proteins in same PDB: d4pc3a1, d4pc3a3, d4pc3b1, d4pc3b3, d4pc3c1, d4pc3c2, d4pc3c3, d4pc3d1, d4pc3d2, d4pc3d3
    automated match to d1efca1
    complexed with gdp, gol

Details for d4pc3a2

PDB Entry: 4pc3 (more details), 1.83 Å

PDB Description: elongation factor tu:ts complex with partially bound gdp
PDB Compounds: (A:) Elongation factor Tu 1

SCOPe Domain Sequences for d4pc3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pc3a2 b.43.3.0 (A:205-296) automated matches {Escherichia coli [TaxId: 83333]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d4pc3a2:

Click to download the PDB-style file with coordinates for d4pc3a2.
(The format of our PDB-style files is described here.)

Timeline for d4pc3a2: