Lineage for d4pc3d2 (4pc3 D:55-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945956Fold d.43: EF-Ts domain-like [54712] (2 superfamilies)
    beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123
  4. 2945957Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) (S)
    comprises two structural repeats of this fold
  5. 2945958Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (2 proteins)
  6. 2945979Protein Elongation factor Ts (EF-Ts), dimerisation domain, N-terminal domain [419040] (2 species)
  7. 2945983Species Escherichia coli [TaxId:562] [419524] (6 PDB entries)
    species duplication: consists of two subdomains of this fold
  8. 2945985Domain d4pc3d2: 4pc3 D:55-139 [272308]
    Other proteins in same PDB: d4pc3a1, d4pc3a2, d4pc3a3, d4pc3b1, d4pc3b2, d4pc3b3, d4pc3c1, d4pc3c3, d4pc3d1, d4pc3d3
    automated match to d1efub4
    complexed with gdp, gol

Details for d4pc3d2

PDB Entry: 4pc3 (more details), 1.83 Å

PDB Description: elongation factor tu:ts complex with partially bound gdp
PDB Compounds: (D:) elongation factor ts

SCOPe Domain Sequences for d4pc3d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pc3d2 d.43.1.1 (D:55-139) Elongation factor Ts (EF-Ts), dimerisation domain, N-terminal domain {Escherichia coli [TaxId: 562]}
vaadgviktkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqf
eeervalvakigeninirrvaaleg

SCOPe Domain Coordinates for d4pc3d2:

Click to download the PDB-style file with coordinates for d4pc3d2.
(The format of our PDB-style files is described here.)

Timeline for d4pc3d2: