SCOP 1.67: Domain d1swua_: 1swu A:

Lineage for d1swua_ (1swu A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.61: Streptavidin-like [50875] (6 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (113 PDB entries)

8. Domain d1swua_: 1swu A: [27230]

Details for d1swua_

PDB Entry: 1swu, 1.14 Å

PDB Description: streptavidin mutant y43f

SCOP Domain Sequences for d1swua_:

Sequence; same for both SEQRES and ATOM records:

>d1swua_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtfesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp

Timeline for d1swua_:

• d1swua_ first appeared (with stable ids) in SCOP 1.55
  
• d1swua_ appears in SCOP 1.65
  
• d1swua_ appears in SCOP 1.69
  
• d1swua_ appears in the current release, SCOPe 2.08