![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.43: EF-Ts domain-like [54712] (2 superfamilies) beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123 |
![]() | Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) ![]() comprises two structural repeats of this fold |
![]() | Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (2 proteins) |
![]() | Protein Elongation factor Ts (EF-Ts), dimerisation domain, C-terminal domain [419041] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [419525] (6 PDB entries) species duplication: consists of two subdomains of this fold |
![]() | Domain d4pc1d3: 4pc1 D:140-279 [272299] Other proteins in same PDB: d4pc1a1, d4pc1a2, d4pc1a3, d4pc1b1, d4pc1b2, d4pc1b3, d4pc1c1, d4pc1c2, d4pc1d1, d4pc1d2 automated match to d1efub2 complexed with gol, pb, po4, trs has additional insertions and/or extensions that are not grouped together |
PDB Entry: 4pc1 (more details), 1.95 Å
SCOPe Domain Sequences for d4pc1d3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pc1d3 d.43.1.1 (D:140-279) Elongation factor Ts (EF-Ts), dimerisation domain, C-terminal domain {Escherichia coli [TaxId: 562]} dvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikpedvsaevvekeyqvqld iamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvgqllkehnaevtgfirfe vgegiekvetdfaaevaams
Timeline for d4pc1d3: