| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.43: EF-Ts domain-like [54712] (2 superfamilies) beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123 |
Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) ![]() comprises two structural repeats of this fold |
| Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein) |
| Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species) |
| Species Escherichia coli [TaxId:562] [54716] (6 PDB entries) duplication: consists of two subdomains of this fold |
| Domain d4pc1c3: 4pc1 C:140-280 [272296] Other proteins in same PDB: d4pc1a1, d4pc1a2, d4pc1a3, d4pc1b1, d4pc1b2, d4pc1b3, d4pc1c1, d4pc1d1 automated match to d1efub2 complexed with gol, pb, po4, trs |
PDB Entry: 4pc1 (more details), 1.95 Å
SCOPe Domain Sequences for d4pc1c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pc1c3 d.43.1.1 (C:140-280) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]}
dvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikpedvsaevvekeyqvqld
iamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvgqllkehnaevtgfirfe
vgegiekvetdfaaevaamsk
Timeline for d4pc1c3: