Lineage for d4pc1c2 (4pc1 C:55-139)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903540Fold d.43: EF-Ts domain-like [54712] (2 superfamilies)
    beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123
  4. 1903541Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) (S)
    comprises two structural repeats of this fold
  5. 1903542Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)
  6. 1903543Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species)
  7. 1903547Species Escherichia coli [TaxId:562] [54716] (6 PDB entries)
    duplication: consists of two subdomains of this fold
  8. 1903556Domain d4pc1c2: 4pc1 C:55-139 [272295]
    Other proteins in same PDB: d4pc1a1, d4pc1a2, d4pc1a3, d4pc1b1, d4pc1b2, d4pc1b3, d4pc1c1, d4pc1d1
    automated match to d1efub4
    complexed with gol, pb, po4, trs

Details for d4pc1c2

PDB Entry: 4pc1 (more details), 1.95 Å

PDB Description: elongation factor tu:ts complex with a bound phosphate
PDB Compounds: (C:) elongation factor ts

SCOPe Domain Sequences for d4pc1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pc1c2 d.43.1.1 (C:55-139) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]}
vaadgviktkidgnygiilevncqtdfvakdagfqafadkvldaavagkitdvevlkaqf
eeervalvakigeninirrvaaleg

SCOPe Domain Coordinates for d4pc1c2:

Click to download the PDB-style file with coordinates for d4pc1c2.
(The format of our PDB-style files is described here.)

Timeline for d4pc1c2: