Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.3: Thrombin inhibitor [50872] (1 protein) topology permutation: strands 2 and 3 swapped their positions in the barrel automatically mapped to Pfam PF03973 |
Protein Thrombin inhibitor [50873] (1 species) |
Species Triatomine bug (Triatoma pallidipennis) [TaxId:30077] [50874] (1 PDB entry) |
Domain d1avgi_: 1avg I: [27229] Other proteins in same PDB: d1avg.1 |
PDB Entry: 1avg (more details), 2.6 Å
SCOPe Domain Sequences for d1avgi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1avgi_ b.60.1.3 (I:) Thrombin inhibitor {Triatomine bug (Triatoma pallidipennis) [TaxId: 30077]} aegddcsiekamgdfkpeeffngtwylahgpgvtspavcqkfttsgskgftqiveigynk fesnvkfqcnqvdnkngeqysfkckssdntefeadftfisvsydnfalvcrsitftsqpk edrylvfertksdtdpdakeic
Timeline for d1avgi_: