Lineage for d1avgi_ (1avg I:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1800621Family b.60.1.3: Thrombin inhibitor [50872] (1 protein)
    topology permutation: strands 2 and 3 swapped their positions in the barrel
    automatically mapped to Pfam PF03973
  6. 1800622Protein Thrombin inhibitor [50873] (1 species)
  7. 1800623Species Triatomine bug (Triatoma pallidipennis) [TaxId:30077] [50874] (1 PDB entry)
  8. 1800624Domain d1avgi_: 1avg I: [27229]
    Other proteins in same PDB: d1avg.1

Details for d1avgi_

PDB Entry: 1avg (more details), 2.6 Å

PDB Description: thrombin inhibitor from triatoma pallidipennis
PDB Compounds: (I:) triabin

SCOPe Domain Sequences for d1avgi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avgi_ b.60.1.3 (I:) Thrombin inhibitor {Triatomine bug (Triatoma pallidipennis) [TaxId: 30077]}
aegddcsiekamgdfkpeeffngtwylahgpgvtspavcqkfttsgskgftqiveigynk
fesnvkfqcnqvdnkngeqysfkckssdntefeadftfisvsydnfalvcrsitftsqpk
edrylvfertksdtdpdakeic

SCOPe Domain Coordinates for d1avgi_:

Click to download the PDB-style file with coordinates for d1avgi_.
(The format of our PDB-style files is described here.)

Timeline for d1avgi_: