SCOPe 2.08: Domain d4onnb_: 4onn B:

Lineage for d4onnb_ (4onn B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries)

8. Domain d4onnb_: 4onn B: [272279]
   Other proteins in same PDB: d4onna_
   automated match to d1x23d_
   complexed with by1, gol

Details for d4onnb_

PDB Entry: 4onn, 1.5 Å

PDB Description: crystal structure of human mms2/ubc13 - bay 11-7082

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d4onnb_:

Sequence; same for both SEQRES and ATOM records:

>d4onnb_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
andvaeqwktneaqaietarawtrlyamn

Timeline for d4onnb_:

• d4onnb_ first appeared in SCOPe 2.05
  
• d4onnb_ appears in SCOPe 2.07