Lineage for d4onna_ (4onn A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546043Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2546113Species Human (Homo sapiens), E2 variant 1 [TaxId:9606] [143051] (7 PDB entries)
    Uniprot Q13404 80-221! Uniprot Q13404 82-220
  8. 2546117Domain d4onna_: 4onn A: [272278]
    Other proteins in same PDB: d4onnb_
    automated match to d2c2vc1
    complexed with by1, gol

Details for d4onna_

PDB Entry: 4onn (more details), 1.5 Å

PDB Description: crystal structure of human mms2/ubc13 - bay 11-7082
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 variant 2

SCOPe Domain Sequences for d4onna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4onna_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]}
gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
mmskenmklpqppegqtynn

SCOPe Domain Coordinates for d4onna_:

Click to download the PDB-style file with coordinates for d4onna_.
(The format of our PDB-style files is described here.)

Timeline for d4onna_: