Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
Species Human (Homo sapiens), E2 variant 1 [TaxId:9606] [143051] (7 PDB entries) Uniprot Q13404 80-221! Uniprot Q13404 82-220 |
Domain d4onma_: 4onm A: [272276] Other proteins in same PDB: d4onmb_ automated match to d2c2vc1 complexed with gol, n2f |
PDB Entry: 4onm (more details), 1.35 Å
SCOPe Domain Sequences for d4onma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4onma_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl mmskenmklpqppegqtynn
Timeline for d4onma_: