Lineage for d4onma_ (4onm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939054Species Human (Homo sapiens), E2 variant 1 [TaxId:9606] [143051] (7 PDB entries)
    Uniprot Q13404 80-221! Uniprot Q13404 82-220
  8. 2939055Domain d4onma_: 4onm A: [272276]
    Other proteins in same PDB: d4onmb_
    automated match to d2c2vc1
    complexed with gol, n2f

Details for d4onma_

PDB Entry: 4onm (more details), 1.35 Å

PDB Description: crystal structure of human mms2/ubc13 - nsc697923
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 variant 2

SCOPe Domain Sequences for d4onma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4onma_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]}
gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
mmskenmklpqppegqtynn

SCOPe Domain Coordinates for d4onma_:

Click to download the PDB-style file with coordinates for d4onma_.
(The format of our PDB-style files is described here.)

Timeline for d4onma_: