SCOPe 2.06: Domain d1eala_: 1eal A:

Lineage for d1eala_ (1eal A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Ileal lipid-binding protein [50870] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50871] (2 PDB entries)

8. Domain d1eala_: 1eal A: [27227]

Details for d1eala_

PDB Entry: 1eal

PDB Description: nmr study of ileal lipid binding protein

PDB Compounds: (A:) ileal lipid binding protein

SCOPe Domain Sequences for d1eala_:

Sequence; same for both SEQRES and ATOM records:

>d1eala_ b.60.1.2 (A:) Ileal lipid-binding protein {Pig (Sus scrofa) [TaxId: 9823]}
aftgkyeieseknydefmkrlalpsdaidkarnlkiisevkqdgqnftwsqqypgghsit
ntftigkecdietiggkkfkatvqmeggkvvvnspnyhhtaeivdgklvevstvggvsye
rvskkla

Timeline for d1eala_:

• d1eala_ first appeared (with stable ids) in SCOP 1.55, called d1eal__
  
• d1eala_ appears in SCOPe 2.05
  
• d1eala_ appears in SCOPe 2.07
  
• d1eala_ appears in the current release, SCOPe 2.08