| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (29 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
| Domain d4nhud1: 4nhu D:2-111 [272269] Other proteins in same PDB: d4nhua2, d4nhua3, d4nhuc2, d4nhuc3 automated match to d3q5ya1 |
PDB Entry: 4nhu (more details), 2.9 Å
SCOPe Domain Sequences for d4nhud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nhud1 b.1.1.0 (D:2-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvle
Timeline for d4nhud1: