Lineage for d4n25a3 (4n25 A:295-665)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537906Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2537907Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2538050Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 2538051Protein automated matches [190175] (9 species)
    not a true protein
  7. 2538071Species Human (Homo sapiens) [TaxId:9606] [187904] (25 PDB entries)
  8. 2538089Domain d4n25a3: 4n25 A:295-665 [272261]
    Other proteins in same PDB: d4n25a1, d4n25a2, d4n25a4
    automated match to d3b1ua3
    complexed with act, ca, mpd, mrd

Details for d4n25a3

PDB Entry: 4n25 (more details), 1.93 Å

PDB Description: crystal structure of protein arginine deiminase 2 (250 um ca2+)
PDB Compounds: (A:) Protein-arginine deiminase type-2

SCOPe Domain Sequences for d4n25a3:

Sequence, based on SEQRES records: (download)

>d4n25a3 d.126.1.0 (A:295-665) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apwimtpnilppvsvfvccmkdnylflkevknlvektncelkvcfqylnrgdrwiqdeie
fgyieaphkgfpvvldsprdgnlkdfpvkellgpdfgyvtreplfesvtsldsfgnlevs
ppvtvngktyplgriligssfplsggrrmtkvvrdflkaqqvqapvelysdwltvghvde
fmsfvpipgtkkflllmastsacyklfrekqkdghgeaimfkglggmsskritinkilsn
eslvqenlyfqrcldwnrdilkkelglteqdiidlpalfkmdedhraraffpnmvnmivl
dkdlgipkpfgpqveeecclemhvrglleplglectfiddisayhkflgevhcgtnvrrk
pftfkwwhmvp

Sequence, based on observed residues (ATOM records): (download)

>d4n25a3 d.126.1.0 (A:295-665) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apwimtpnilppvsvfvccmkdnylflkevknlvektncelkvcfqylnrgdrwiqdeie
fgyieaphkgfpvvldsprdggpdfgyvsvtsldsfgnlevsppvtvngktyplgrilig
ssfplsggrrmtkvvrdflkaqqvqapvelysdwltvghvdefmsfvpipgtkkflllma
stsacyklfrekqkdghgeaimfkglggmsskritinkilsneslvqenlyfqrcldwnr
dilkkelglteqdiidlpalfkmdedhraraffpnmvnmivldkdlgipkpfgpqveeec
clemhvrglleplglectfiddisayhkflgevhcgtnvrrkpftfkwwhmvp

SCOPe Domain Coordinates for d4n25a3:

Click to download the PDB-style file with coordinates for d4n25a3.
(The format of our PDB-style files is described here.)

Timeline for d4n25a3: