Lineage for d4n25a2 (4n25 A:116-294)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2768533Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (2 families) (S)
    automatically mapped to Pfam PF08527
  5. 2768554Family b.2.9.0: automated matches [272207] (1 protein)
    not a true family
  6. 2768555Protein automated matches [272208] (1 species)
    not a true protein
  7. 2768556Species Human (Homo sapiens) [TaxId:9606] [272209] (26 PDB entries)
  8. 2768572Domain d4n25a2: 4n25 A:116-294 [272260]
    Other proteins in same PDB: d4n25a1, d4n25a3, d4n25a4
    automated match to d2dexx1
    complexed with act, ca, mpd, mrd

Details for d4n25a2

PDB Entry: 4n25 (more details), 1.93 Å

PDB Description: crystal structure of protein arginine deiminase 2 (250 um ca2+)
PDB Compounds: (A:) Protein-arginine deiminase type-2

SCOPe Domain Sequences for d4n25a2:

Sequence, based on SEQRES records: (download)

>d4n25a2 b.2.9.0 (A:116-294) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieisldvdadrdgvveknnpkkaswtwgpegqgaillvncdretpwlpkedcrdekvysk
edlkdmsqmilrtkgpdrlpagyeivlyismsdsdkvgvfyvenpffgqryihilgrrkl
yhvvkytggsaellffveglcfpdegfsglvsihvslleymaqdipltpiftdtvifri

Sequence, based on observed residues (ATOM records): (download)

>d4n25a2 b.2.9.0 (A:116-294) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieisldvdadrdgvveknnpkkaswtwgpegqgaillvncdretkedcrdekvyskedlk
dmsqmilrtkgpdrlpagyeivlyismsdsdkvgvfyvqryihilgrrklyhvvkytggs
aellffveglcfpdegfsglvsihvslleymaqdipltpiftdtvifri

SCOPe Domain Coordinates for d4n25a2:

Click to download the PDB-style file with coordinates for d4n25a2.
(The format of our PDB-style files is described here.)

Timeline for d4n25a2: