Lineage for d4n28a2 (4n28 A:116-294)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2041435Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (2 families) (S)
    automatically mapped to Pfam PF08527
  5. 2041456Family b.2.9.0: automated matches [272207] (1 protein)
    not a true family
  6. 2041457Protein automated matches [272208] (1 species)
    not a true protein
  7. 2041458Species Human (Homo sapiens) [TaxId:9606] [272209] (19 PDB entries)
  8. 2041470Domain d4n28a2: 4n28 A:116-294 [272257]
    Other proteins in same PDB: d4n28a1, d4n28a3, d4n28a4
    automated match to d2dexx1
    complexed with act, ca, mpd

Details for d4n28a2

PDB Entry: 4n28 (more details), 1.88 Å

PDB Description: crystal structure of protein arginine deiminase 2 (1 mm ca2+)
PDB Compounds: (A:) Protein-arginine deiminase type-2

SCOPe Domain Sequences for d4n28a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n28a2 b.2.9.0 (A:116-294) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieisldvdadrdgvveknnpkkaswtwgpegqgaillvncdretpwlpkedcrdekvysk
edlkdmsqmilrtkgpdrlpagyeivlyismsdsdkvgvfyvenpffgqryihilgrrkl
yhvvkytggsaellffveglcfpdegfsglvsihvslleymaqdipltpiftdtvifri

SCOPe Domain Coordinates for d4n28a2:

Click to download the PDB-style file with coordinates for d4n28a2.
(The format of our PDB-style files is described here.)

Timeline for d4n28a2: