| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (2 families) ![]() automatically mapped to Pfam PF08527 |
| Family b.2.9.0: automated matches [272207] (1 protein) not a true family |
| Protein automated matches [272208] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [272209] (26 PDB entries) |
| Domain d4n2aa2: 4n2a A:116-294 [272252] Other proteins in same PDB: d4n2aa1, d4n2aa3, d4n2aa4 automated match to d2dexx1 complexed with act, ca, mpd |
PDB Entry: 4n2a (more details), 1.7 Å
SCOPe Domain Sequences for d4n2aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n2aa2 b.2.9.0 (A:116-294) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieisldvdadrdgvveknnpkkaswtwgpegqgaillvncdretpwlpkedcrdekvysk
edlkdmsqmilrtkgpdrlpagyeivlyismsdsdkvgvfyvenpffgqryihilgrrkl
yhvvkytggsaellffveglcfpdegfsglvsihvslleymaqdipltpiftdtvifri
Timeline for d4n2aa2: