| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries) |
| Domain d4n2da1: 4n2d A:3-115 [272250] Other proteins in same PDB: d4n2da2, d4n2da3, d4n2da4 automated match to d2dexx2 complexed with ca, mpd |
PDB Entry: 4n2d (more details), 2 Å
SCOPe Domain Sequences for d4n2da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n2da1 b.6.1.0 (A:3-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rertvrlqygsrveavyvlgtylwtdvysaapagaqtfslkhsehvwvevvrdgeaeeva
tngkqrwllspsttlrvtmsqasteassdkvtvnyydeegsipidqaglflta
Timeline for d4n2da1: