SCOPe 2.06: Domain d1pmpb_: 1pmp B:

Lineage for d1pmpb_ (1pmp B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein P2 myelin protein [50868] (2 species)

7. Species Cow (Bos taurus), caudal spinal root myelin [TaxId:9913] [50869] (1 PDB entry)

8. Domain d1pmpb_: 1pmp B: [27225]
   complexed with ola

Details for d1pmpb_

PDB Entry: 1pmp, 2.7 Å

PDB Description: crystallographic studies on a family of cellular lipophilic transport proteins. refinement of p2 myelin protein and the structure determination and refinement of cellular retinol-binding protein in complex with all-trans-retinol

PDB Compounds: (B:) p2 myelin protein

SCOPe Domain Sequences for d1pmpb_:

Sequence; same for both SEQRES and ATOM records:

>d1pmpb_ b.60.1.2 (B:) P2 myelin protein {Cow (Bos taurus), caudal spinal root myelin [TaxId: 9913]}
snkflgtwklvssenfdeymkalgvglatrklgnlakprviiskkgdiitirtespfknt
eisfklgqefeettadnrktkstvtlargslnqvqkwngnettikrklvdgkmvveckmk
dvvctriyekv

Timeline for d1pmpb_:

• d1pmpb_ first appeared (with stable ids) in SCOP 1.55
  
• d1pmpb_ appears in SCOPe 2.05
  
• d1pmpb_ appears in SCOPe 2.07
  
• d1pmpb_ appears in the current release, SCOPe 2.08