![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries) |
![]() | Domain d4n2ma1: 4n2m A:3-115 [272218] Other proteins in same PDB: d4n2ma2, d4n2ma3, d4n2ma4 automated match to d2dexx2 complexed with act, ca, mpd |
PDB Entry: 4n2m (more details), 1.6 Å
SCOPe Domain Sequences for d4n2ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n2ma1 b.6.1.0 (A:3-115) automated matches {Human (Homo sapiens) [TaxId: 9606]} rertvrlqygsrveavyvlgtylwtdvysaapagaqtfslkhsehvwvevvrdgeaeeva tngkqrwllspsttlrvtmsqasteassdkvtvnyydeegsipidqaglflta
Timeline for d4n2ma1: