Lineage for d4n2fa1 (4n2f A:2-115)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772475Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries)
  8. 2772483Domain d4n2fa1: 4n2f A:2-115 [272214]
    Other proteins in same PDB: d4n2fa2, d4n2fa3, d4n2fa4
    automated match to d2dexx2
    complexed with act, ca, mpd

Details for d4n2fa1

PDB Entry: 4n2f (more details), 1.8 Å

PDB Description: crystal structure of protein arginine deiminase 2 (d169a, 0 mm ca2+)
PDB Compounds: (A:) Protein-arginine deiminase type-2

SCOPe Domain Sequences for d4n2fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n2fa1 b.6.1.0 (A:2-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrertvrlqygsrveavyvlgtylwtdvysaapagaqtfslkhsehvwvevvrdgeaeev
atngkqrwllspsttlrvtmsqasteassdkvtvnyydeegsipidqaglflta

SCOPe Domain Coordinates for d4n2fa1:

Click to download the PDB-style file with coordinates for d4n2fa1.
(The format of our PDB-style files is described here.)

Timeline for d4n2fa1: