Lineage for d1eiia_ (1eii A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.2: Fatty acid binding protein-like [50847] (10 proteins) 
Protein Cellular retinol-binding protein II (CRBP) [50864] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [50865] (5 PDB entries) 
Domain d1eiia_: 1eii A: [27221]
Details for d1eiia_
PDB Entry: 1eii (more details)
PDB Description: nmr structure of holo cellular retinol-binding protein ii
SCOP Domain Sequences for d1eiia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eiia_ b.60.1.2 (A:) Cellular retinol-binding protein II (CRBP) {Rat (Rattus norvegicus)}
mtkdqngtwemesnenfegymkaldidfatrkiavrltqtkiivqdgdnfktktnstfrn
ydldftvgvefdehtkgldgrnvktlvtwegntlvcvqkgekenrgwkqwvegdklylel
tcgdqvcrqvfkkk
SCOP Domain Coordinates for d1eiia_:
Click to download the PDB-style file with coordinates for d1eiia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eiia_:
- d1eiia_ appears in SCOP 1.57
- d1eiia_ appears in the current release, SCOPe 2.08
View in 3D