Class b: All beta proteins [48724] (176 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188940] (24 PDB entries) |
Domain d4n2ia1: 4n2i A:2-115 [272205] Other proteins in same PDB: d4n2ia2, d4n2ia3 automated match to d2dexx2 complexed with act, ca, mpd |
PDB Entry: 4n2i (more details), 1.9 Å
SCOPe Domain Sequences for d4n2ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n2ia1 b.6.1.0 (A:2-115) automated matches {Human (Homo sapiens) [TaxId: 9606]} lrertvrlqygsrveavyvlgtylwtdvysaapagaqtfslkhsehvwvevvrdgeaeev atngkqrwllspsttlrvtmsqasteassdkvtvnyydeegsipidqaglflta
Timeline for d4n2ia1: