Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (23 species) not a true protein |
Species Chlamydomonas reinhardtii [TaxId:3055] [272201] (1 PDB entry) |
Domain d2mqha_: 2mqh A: [272202] automated match to d3a0ja_ |
PDB Entry: 2mqh (more details)
SCOPe Domain Sequences for d2mqha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mqha_ b.40.4.0 (A:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} gsgeqlrqqgtvkwfnatkgfgfitpggggedlfvhqtninsegfrslregevvefevea gpdgrskavnvt
Timeline for d2mqha_: