![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
![]() | Protein automated matches [190896] (9 species) not a true protein |
![]() | Species Rattus norvegicus [TaxId:10116] [272199] (3 PDB entries) |
![]() | Domain d2mqma_: 2mqm A: [272200] automated match to d2e5ia_ |
PDB Entry: 2mqm (more details)
SCOPe Domain Sequences for d2mqma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mqma_ d.58.7.0 (A:) automated matches {Rattus norvegicus [TaxId: 10116]} qkisrpgdsddsrsvnsvllftilnpiysittdvlyticnpcgpvqrivifrkngvqamv efdsvqsaqrakaslngadiysgcctlkieyakptrlnvfkndqdtwdytnpnlsgqg
Timeline for d2mqma_: