Lineage for d2mqma_ (2mqm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952695Species Norway rat (Rattus norvegicus) [TaxId:10116] [272199] (3 PDB entries)
  8. 2952698Domain d2mqma_: 2mqm A: [272200]
    automated match to d2e5ia_

Details for d2mqma_

PDB Entry: 2mqm (more details)

PDB Description: structural investigation of hnrnp l
PDB Compounds: (A:) Protein Hnrnpl

SCOPe Domain Sequences for d2mqma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mqma_ d.58.7.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qkisrpgdsddsrsvnsvllftilnpiysittdvlyticnpcgpvqrivifrkngvqamv
efdsvqsaqrakaslngadiysgcctlkieyakptrlnvfkndqdtwdytnpnlsgqg

SCOPe Domain Coordinates for d2mqma_:

Click to download the PDB-style file with coordinates for d2mqma_.
(The format of our PDB-style files is described here.)

Timeline for d2mqma_: