Lineage for d4hsja_ (4hsj A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424562Family b.82.1.20: 3-hydroxyanthranilic acid dioxygenase-like [141618] (2 proteins)
    Pfam PF06052; 3-HAO
  6. 2424563Protein 3-hydroxyanthranilate-3,4-dioxygenase [141619] (2 species)
  7. 2424566Species Ralstonia metallidurans [TaxId:119219] [141620] (11 PDB entries)
    Uniprot Q1LCS4 1-174
  8. 2424573Domain d4hsja_: 4hsj A: [272197]
    automated match to d1yfua1
    complexed with 6pc, fe2

Details for d4hsja_

PDB Entry: 4hsj (more details), 1.88 Å

PDB Description: 1.88 angstrom x-ray crystal structure of piconlinic-bound 3- hydroxyanthranilate-3,4-dioxygenase
PDB Compounds: (A:) 3-hydroxyanthranilate 3,4-dioxygenase

SCOPe Domain Sequences for d4hsja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hsja_ b.82.1.20 (A:) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]}
mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa

SCOPe Domain Coordinates for d4hsja_:

Click to download the PDB-style file with coordinates for d4hsja_.
(The format of our PDB-style files is described here.)

Timeline for d4hsja_: