SCOPe 2.08: Domain d5b8fa1: 5b8f A:1-157

Lineage for d5b8fa1 (5b8f A:1-157)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.0: automated matches [191525] (1 protein)
   not a true family

6. Protein automated matches [190884] (7 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [272191] (1 PDB entry)

8. Domain d5b8fa1: 5b8f A:1-157 [272195]
   Other proteins in same PDB: d5b8fa2, d5b8fb2, d5b8fc2
   automated match to d4c8ia_
   complexed with c5p, mg, mpd, po4

Details for d5b8fa1

PDB Entry: 5b8f, 1.45 Å

PDB Description: x-ray crystal structure of a 2-c-methyl-d-erythritol 2,4- cyclodiphosphate synthase from pseudomonas aeruginosa

PDB Compounds: (A:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d5b8fa1:

Sequence; same for both SEQRES and ATOM records:

>d5b8fa1 d.79.5.0 (A:1-157) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mrighgydvhrfgegdfitlggvriphkhglvahsdgdvllhalsdallgaaalgdigkh
fpdtdprfkgadsrallrhvvaivaekgwkvgnvdativaqapkmaphietmrgliaedl
gvavdqvnvkattterlgftgreegiavhavallmar

Timeline for d5b8fa1:

• d5b8fa1 first appeared in SCOPe 2.05, called d5b8fa_
  
• d5b8fa1 appears in SCOPe 2.07