SCOPe 2.05: Domain d5ah8a_: 5ah8 A:

Lineage for d5ah8a_ (5ah8 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (10 species)
   not a true protein

7. Species Human immunodeficiency virus 1 (z2/cdc-z34 isolate) [TaxId:11683] [189840] (10 PDB entries)

8. Domain d5ah8a_: 5ah8 A: [272194]
   automated match to d2xyfa_
   complexed with c7w, cl

Details for d5ah8a_

PDB Entry: 5ah8, 1.26 Å

PDB Description: disubstituted bis-thf moieties as new p2 ligands in non-peptidal hiv- 1 protease inhibitors (ii)

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d5ah8a_:

Sequence; same for both SEQRES and ATOM records:

>d5ah8a_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 (z2/cdc-z34 isolate) [TaxId: 11683]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

Timeline for d5ah8a_:

• d5ah8a_ is new in SCOPe 2.05-stable
  
• d5ah8a_ appears in SCOPe 2.06
  
• d5ah8a_ appears in the current release, SCOPe 2.08