Class b: All beta proteins [48724] (180 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein automated matches [190433] (12 species) not a true protein |
Species Human immunodeficiency virus 1 (z2/cdc-z34 isolate) [TaxId:11683] [189840] (10 PDB entries) |
Domain d5agzb_: 5agz B: [272189] automated match to d2xyfa_ complexed with cl, qha |
PDB Entry: 5agz (more details), 1.2 Å
SCOPe Domain Sequences for d5agzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5agzb_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus 1 (z2/cdc-z34 isolate) [TaxId: 11683]} pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd qipieicghkaigtvlvgptptnvigrnlltqigctlnf
Timeline for d5agzb_: