SCOPe 2.08: Domain d5ahaa_: 5aha A:

Lineage for d5ahaa_ (5aha A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (12 species)
   not a true protein

7. Species Human immunodeficiency virus 1 (z2/cdc-z34 isolate) [TaxId:11683] [189840] (10 PDB entries)

8. Domain d5ahaa_: 5aha A: [272181]
   automated match to d2xyfa_
   complexed with cl, zlp

Details for d5ahaa_

PDB Entry: 5aha, 1.35 Å

PDB Description: disubstituted bis-thf moieties as new p2 ligands in non-peptidal hiv- 1 protease inhibitors (ii)

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d5ahaa_:

Sequence; same for both SEQRES and ATOM records:

>d5ahaa_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 (z2/cdc-z34 isolate) [TaxId: 11683]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

Timeline for d5ahaa_:

• d5ahaa_ first appeared in SCOPe 2.05
  
• d5ahaa_ appears in SCOPe 2.07