SCOP 1.65: Domain d1opbb_: 1opb B:

Lineage for d1opbb_ (1opb B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (3 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (15 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinol-binding protein II (CRBP) [50864] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50865] (9 PDB entries)

8. Domain d1opbb_: 1opb B: [27217]

Details for d1opbb_

PDB Entry: 1opb, 1.9 Å

PDB Description: the crystal structures of holo-and apo-cellular retinol binding protein ii

SCOP Domain Sequences for d1opbb_:

Sequence; same for both SEQRES and ATOM records:

>d1opbb_ b.60.1.2 (B:) Cellular retinol-binding protein II (CRBP) {Rat (Rattus norvegicus)}
tkdqngtwemesnenfegymkaldidfatrkiavrltqtkiivqdgdnfktktnstfrny
dldftvgvefdehtkgldgrnvktlvtwegntlvcvqkgekenrgwkqwvegdklylelt
cgdqvcrqvfkkk

Timeline for d1opbb_:

• d1opbb_ first appeared (with stable ids) in SCOP 1.55
  
• d1opbb_ appears in SCOP 1.63
  
• d1opbb_ appears in SCOP 1.67
  
• d1opbb_ appears in the current release, SCOPe 2.08