SCOPe 2.06: Domain d5afjb_: 5afj B:

Lineage for d5afjb_ (5afj B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [259757] (10 PDB entries)

8. Domain d5afjb_: 5afj B: [272169]
   automated match to d4uxua_
   complexed with 42r, bma, gol, l0b, man, nag

Details for d5afjb_

PDB Entry: 5afj, 2.22 Å

PDB Description: alpha7-achbp in complex with lobeline and fragment 1

PDB Compounds: (B:) acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7

SCOPe Domain Sequences for d5afjb_:

Sequence; same for both SEQRES and ATOM records:

>d5afjb_ b.96.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
serfyecckepypdvtftvtfrkkg

Timeline for d5afjb_:

• d5afjb_ first appeared in SCOPe 2.05
  
• d5afjb_ appears in SCOPe 2.07
  
• d5afjb_ appears in the current release, SCOPe 2.08