Lineage for d5afhe_ (5afh E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1811013Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 1811014Protein automated matches [193506] (5 species)
    not a true protein
  7. 1811357Species Homo sapiens, [TaxId:9606] [272119] (5 PDB entries)
  8. 1811372Domain d5afhe_: 5afh E: [272164]
    automated match to d4uxua_
    complexed with l0b

Details for d5afhe_

PDB Entry: 5afh (more details), 2.4 Å

PDB Description: alpha7-achbp in complex with lobeline
PDB Compounds: (E:) acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7

SCOPe Domain Sequences for d5afhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5afhe_ b.96.1.0 (E:) automated matches {Homo sapiens, [TaxId: 9606]}
gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
serfyecckepypdvtftvtfrkkg

SCOPe Domain Coordinates for d5afhe_:

Click to download the PDB-style file with coordinates for d5afhe_.
(The format of our PDB-style files is described here.)

Timeline for d5afhe_: