Lineage for d5a1ad5 (5a1a D:731-1023)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782204Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1782343Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1782802Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 1782803Protein automated matches [226849] (5 species)
    not a true protein
  7. 1782886Species Escherichia coli [TaxId:83333] [272144] (1 PDB entry)
  8. 1782890Domain d5a1ad5: 5a1a D:731-1023 [272163]
    Other proteins in same PDB: d5a1aa1, d5a1aa2, d5a1aa3, d5a1aa4, d5a1ab1, d5a1ab2, d5a1ab3, d5a1ab4, d5a1ac1, d5a1ac2, d5a1ac3, d5a1ac4, d5a1ad1, d5a1ad2, d5a1ad3, d5a1ad4
    automated match to d1jz8a4
    complexed with mg, na, ptq

Details for d5a1ad5

PDB Entry: 5a1a (more details), 2.2 Å

PDB Description: 2.2 a resolution cryo-em structure of beta-galactosidase in complex with a cell-permeant inhibitor
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d5a1ad5:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a1ad5 b.30.5.0 (D:731-1023) automated matches {Escherichia coli [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d5a1ad5:

Click to download the PDB-style file with coordinates for d5a1ad5.
(The format of our PDB-style files is described here.)

Timeline for d5a1ad5: