| Class b: All beta proteins [48724] (180 folds) |
| Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
| Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
| Protein automated matches [226849] (8 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [272144] (6 PDB entries) |
| Domain d5a1ab5: 5a1a B:731-1023 [272162] Other proteins in same PDB: d5a1aa1, d5a1aa2, d5a1aa3, d5a1aa4, d5a1ab1, d5a1ab2, d5a1ab3, d5a1ab4, d5a1ac1, d5a1ac2, d5a1ac3, d5a1ac4, d5a1ad1, d5a1ad2, d5a1ad3, d5a1ad4 automated match to d1jz8a4 complexed with mg, na, ptq |
PDB Entry: 5a1a (more details), 2.2 Å
SCOPe Domain Sequences for d5a1ab5:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a1ab5 b.30.5.0 (B:731-1023) automated matches {Escherichia coli [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d5a1ab5:
View in 3DDomains from same chain: (mouse over for more information) d5a1ab1, d5a1ab2, d5a1ab3, d5a1ab4 |