| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
| Protein automated matches [254633] (7 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [272134] (2 PDB entries) |
| Domain d5a1ab4: 5a1a B:626-730 [272159] Other proteins in same PDB: d5a1aa1, d5a1aa3, d5a1aa5, d5a1ab1, d5a1ab3, d5a1ab5, d5a1ac1, d5a1ac3, d5a1ac5, d5a1ad1, d5a1ad3, d5a1ad5 automated match to d1jz8a2 complexed with mg, na, ptq |
PDB Entry: 5a1a (more details), 2.2 Å
SCOPe Domain Sequences for d5a1ab4:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a1ab4 b.1.4.0 (B:626-730) automated matches {Escherichia coli [TaxId: 83333]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d5a1ab4:
View in 3DDomains from same chain: (mouse over for more information) d5a1ab1, d5a1ab2, d5a1ab3, d5a1ab5 |