Lineage for d5a1ab3 (5a1a B:334-625)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820295Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1820296Protein automated matches [190075] (72 species)
    not a true protein
  7. 1820469Species Escherichia coli [TaxId:83333] [272137] (2 PDB entries)
  8. 1820471Domain d5a1ab3: 5a1a B:334-625 [272156]
    Other proteins in same PDB: d5a1aa1, d5a1aa2, d5a1aa4, d5a1aa5, d5a1ab1, d5a1ab2, d5a1ab4, d5a1ab5, d5a1ac1, d5a1ac2, d5a1ac4, d5a1ac5, d5a1ad1, d5a1ad2, d5a1ad4, d5a1ad5
    automated match to d1jz7a5
    complexed with mg, na, ptq

Details for d5a1ab3

PDB Entry: 5a1a (more details), 2.2 Å

PDB Description: 2.2 a resolution cryo-em structure of beta-galactosidase in complex with a cell-permeant inhibitor
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d5a1ab3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a1ab3 c.1.8.0 (B:334-625) automated matches {Escherichia coli [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d5a1ab3:

Click to download the PDB-style file with coordinates for d5a1ab3.
(The format of our PDB-style files is described here.)

Timeline for d5a1ab3: