Lineage for d5a1ab1 (5a1a B:2-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384843Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries)
  8. 2384861Domain d5a1ab1: 5a1a B:2-219 [272152]
    Other proteins in same PDB: d5a1aa2, d5a1aa3, d5a1aa4, d5a1aa5, d5a1ab2, d5a1ab3, d5a1ab4, d5a1ab5, d5a1ac2, d5a1ac3, d5a1ac4, d5a1ac5, d5a1ad2, d5a1ad3, d5a1ad4, d5a1ad5
    automated match to d1f4ha3
    complexed with mg, na, ptq

Details for d5a1ab1

PDB Entry: 5a1a (more details), 2.2 Å

PDB Description: 2.2 a resolution cryo-em structure of beta-galactosidase in complex with a cell-permeant inhibitor
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d5a1ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a1ab1 b.18.1.0 (B:2-219) automated matches {Escherichia coli [TaxId: 83333]}
mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa
wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg
cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage
nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d5a1ab1:

Click to download the PDB-style file with coordinates for d5a1ab1.
(The format of our PDB-style files is described here.)

Timeline for d5a1ab1: