Class b: All beta proteins [48724] (141 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (5 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (15 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Cellular retinol-binding protein II (CRBP) [50864] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [50865] (9 PDB entries) |
Domain d1opab_: 1opa B: [27215] |
PDB Entry: 1opa (more details), 1.9 Å
SCOP Domain Sequences for d1opab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opab_ b.60.1.2 (B:) Cellular retinol-binding protein II (CRBP) {Rat (Rattus norvegicus)} tkdqngtwemesnenfegymkaldidfatrkiavrltqtkiivqdgdnfktktnstfrny dldftvgvefdehtkgldgrnvktlvtwegntlvcvqkgekenrgwkqwvegdklylelt cgdqvcrqvfkkk
Timeline for d1opab_: