Lineage for d5afla_ (5afl A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408524Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2408525Protein automated matches [193506] (5 species)
    not a true protein
  7. 2408913Species Human (Homo sapiens) [TaxId:9606] [259757] (11 PDB entries)
  8. 2408932Domain d5afla_: 5afl A: [272148]
    automated match to d4uxua_
    complexed with bma, fhv, gol, l0b, nag, ndg, tla

Details for d5afla_

PDB Entry: 5afl (more details), 2.39 Å

PDB Description: alpha7-achbp in complex with lobeline and fragment 3
PDB Compounds: (A:) acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7

SCOPe Domain Sequences for d5afla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5afla_ b.96.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
serfyecckepypdvtftvtfrkkg

SCOPe Domain Coordinates for d5afla_:

Click to download the PDB-style file with coordinates for d5afla_.
(The format of our PDB-style files is described here.)

Timeline for d5afla_: