![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
![]() | Protein Cellular retinol-binding protein II (CRBP) [50864] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [50865] (9 PDB entries) |
![]() | Domain d1opaa_: 1opa A: [27214] |
PDB Entry: 1opa (more details), 1.9 Å
SCOPe Domain Sequences for d1opaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opaa_ b.60.1.2 (A:) Cellular retinol-binding protein II (CRBP) {Norway rat (Rattus norvegicus) [TaxId: 10116]} tkdqngtwemesnenfegymkaldidfatrkiavrltqtkiivqdgdnfktktnstfrny dldftvgvefdehtkgldgrnvktlvtwegntlvcvqkgekenrgwkqwvegdklylelt cgdqvcrqvfkkk
Timeline for d1opaa_: