Lineage for d5a1ac2 (5a1a C:220-333)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372926Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2372927Protein automated matches [254633] (16 species)
    not a true protein
  7. 2373157Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries)
  8. 2373190Domain d5a1ac2: 5a1a C:220-333 [272136]
    Other proteins in same PDB: d5a1aa1, d5a1aa3, d5a1aa5, d5a1ab1, d5a1ab3, d5a1ab5, d5a1ac1, d5a1ac3, d5a1ac5, d5a1ad1, d5a1ad3, d5a1ad5
    automated match to d1jz8a1
    complexed with mg, na, ptq

Details for d5a1ac2

PDB Entry: 5a1a (more details), 2.2 Å

PDB Description: 2.2 a resolution cryo-em structure of beta-galactosidase in complex with a cell-permeant inhibitor
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d5a1ac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a1ac2 b.1.4.0 (C:220-333) automated matches {Escherichia coli [TaxId: 83333]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d5a1ac2:

Click to download the PDB-style file with coordinates for d5a1ac2.
(The format of our PDB-style files is described here.)

Timeline for d5a1ac2: