| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries) |
| Domain d5a1ac1: 5a1a C:2-219 [272133] Other proteins in same PDB: d5a1aa2, d5a1aa3, d5a1aa4, d5a1aa5, d5a1ab2, d5a1ab3, d5a1ab4, d5a1ab5, d5a1ac2, d5a1ac3, d5a1ac4, d5a1ac5, d5a1ad2, d5a1ad3, d5a1ad4, d5a1ad5 automated match to d1f4ha3 complexed with mg, na, ptq |
PDB Entry: 5a1a (more details), 2.2 Å
SCOPe Domain Sequences for d5a1ac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a1ac1 b.18.1.0 (C:2-219) automated matches {Escherichia coli [TaxId: 83333]}
mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa
wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg
cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage
nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d5a1ac1:
View in 3DDomains from same chain: (mouse over for more information) d5a1ac2, d5a1ac3, d5a1ac4, d5a1ac5 |