![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (31 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [272122] (2 PDB entries) |
![]() | Domain d5a1aa1: 5a1a A:2-219 [272132] Other proteins in same PDB: d5a1aa2, d5a1aa3, d5a1aa4, d5a1aa5, d5a1ab2, d5a1ab3, d5a1ab4, d5a1ab5, d5a1ac2, d5a1ac3, d5a1ac4, d5a1ac5, d5a1ad2, d5a1ad3, d5a1ad4, d5a1ad5 automated match to d1f4ha3 complexed with mg, na, ptq |
PDB Entry: 5a1a (more details), 2.2 Å
SCOPe Domain Sequences for d5a1aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a1aa1 b.18.1.0 (A:2-219) automated matches {Escherichia coli [TaxId: 83333]} mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d5a1aa1:
![]() Domains from same chain: (mouse over for more information) d5a1aa2, d5a1aa3, d5a1aa4, d5a1aa5 |